Recombinant Chlamydia trachomatis serovar L2 Major outer membrane porin (ompA), Unconjugated, E. coli

Catalog Number: BIM-RPC20355
Article Name: Recombinant Chlamydia trachomatis serovar L2 Major outer membrane porin (ompA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20355
Supplier Catalog Number: RPC20355
Alternative Catalog Number: BIM-RPC20355-20UG,BIM-RPC20355-100UG,BIM-RPC20355-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: MOMP
Recombinant Chlamydia trachomatis serovar L2 Major outer membrane porin (ompA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B). Target Name: ompA. Target Synonyms: MOMP. Accession Number: P06597. Expression Region: 23~394aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLQTDVNKEFQMGAKPTTATGNAAAPSTCTARENPAYGRHMQDAEMFTNAAYMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENHATVSDSKLVPNMSLDQSVVELYTDTTFAWSAGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLDLKAGTDGVTGTKDASIDYHEWQASLA
Target: ompA