Recombinant Arabidopsis thaliana Alcohol dehydrogenase class-3 (ADH2), Unconjugated, E. coli

Catalog Number: BIM-RPC20357
Article Name: Recombinant Arabidopsis thaliana Alcohol dehydrogenase class-3 (ADH2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20357
Supplier Catalog Number: RPC20357
Alternative Catalog Number: BIM-RPC20357-20UG,BIM-RPC20357-100UG,BIM-RPC20357-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: Alcohol dehydrogenase class-IIIGlutathione-dependent formaldehyde dehydrogenase
Recombinant Arabidopsis thaliana Alcohol dehydrogenase class-3 (ADH2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: ADH2. Target Synonyms: Alcohol dehydrogenase class-IIIGlutathione-dependent formaldehyde dehydrogenase. Accession Number: Q96533. Expression Region: 2~379aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ATQGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQAGDHVIPCYQAECRECKFCKSGKTNLCGKVRSATGVGIMMNDRKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKIDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKFGVNEFVNPKDHDKPIQEV
Target: ADH2