Recombinant Chlamydia trachomatis Large cysteine-rich periplasmic protein OmcB (omcB), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20358
Article Name: Recombinant Chlamydia trachomatis Large cysteine-rich periplasmic protein OmcB (omcB), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20358
Supplier Catalog Number: RPC20358
Alternative Catalog Number: BIM-RPC20358-20UG,BIM-RPC20358-100UG,BIM-RPC20358-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Large-CRP60 kDa cysteine-rich OMP60 kDa outer membrane proteinCysteine-rich outer membrane proteinCRP
Recombinant Chlamydia trachomatis Large cysteine-rich periplasmic protein OmcB (omcB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chlamydia trachomatis (strain D/UW-3/Cx). Target Name: omcB. Target Synonyms: Large-CRP60 kDa cysteine-rich OMP60 kDa outer membrane proteinCysteine-rich outer membrane proteinCRP. Accession Number: P0CC04. Expression Region: 41~196aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA
Target: omcB