Recombinant E. coli Peptidyl-prolyl cis-trans isomerase A (ppiA), Unconjugated

Catalog Number: BIM-RPC20361
Article Name: Recombinant E. coli Peptidyl-prolyl cis-trans isomerase A (ppiA), Unconjugated
Biozol Catalog Number: BIM-RPC20361
Supplier Catalog Number: RPC20361
Alternative Catalog Number: BIM-RPC20361-20UG,BIM-RPC20361-100UG,BIM-RPC20361-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: PPIase ACyclophilin ARotamase A
Recombinant E. coli Peptidyl-prolyl cis-trans isomerase A (ppiA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: ppiA. Target Synonyms: PPIase ACyclophilin ARotamase A. Accession Number: P0AFL5. Expression Region: 25~190aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
Target: ppiA