Recombinant Rat Monoglyceride lipase (Mgll), Unconjugated, Yeast

Catalog Number: BIM-RPC20364
Article Name: Recombinant Rat Monoglyceride lipase (Mgll), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20364
Supplier Catalog Number: RPC20364
Alternative Catalog Number: BIM-RPC20364-20UG,BIM-RPC20364-100UG,BIM-RPC20364-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: MGLMonoacylglycerol lipaseMAGL
Recombinant Rat Monoglyceride lipase (Mgll) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Mgll. Target Synonyms: MGLMonoacylglycerol lipaseMAGL. Accession Number: Q8R431. Expression Region: 1~303aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 34.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDYPEVPVFLLGHSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRIDSSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSP
Target: Mgll