Recombinant Raphanus sativus Defensin-like protein 2 (AFP2), Unconjugated, E. coli

Catalog Number: BIM-RPC20365
Article Name: Recombinant Raphanus sativus Defensin-like protein 2 (AFP2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20365
Supplier Catalog Number: RPC20365
Alternative Catalog Number: BIM-RPC20365-20UG,BIM-RPC20365-100UG,BIM-RPC20365-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Cysteine-rich antifungal protein 2AFP2RAFP2
Recombinant Raphanus sativus Defensin-like protein 2 (AFP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Raphanus sativus (Radish). Target Name: AFP2. Target Synonyms: Cysteine-rich antifungal protein 2AFP2RAFP2. Accession Number: P30230. Expression Region: 30~80aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 21.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Target: AFP2