Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1), Unconjugated, E. coli

Catalog Number: BIM-RPC20366
Article Name: Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20366
Supplier Catalog Number: RPC20366
Alternative Catalog Number: BIM-RPC20366-20UG,BIM-RPC20366-100UG,BIM-RPC20366-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Yeast
Conjugation: Unconjugated
Alternative Names: Nicotine deamidaseNAMase
Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Target Name: PNC1. Target Synonyms: Nicotine deamidaseNAMase. Accession Number: P53184. Expression Region: 1~216aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Target: PNC1