Recombinant Rickettsia japonica 17KDA surface antigen (omp), Unconjugated, E. coli

Catalog Number: BIM-RPC20380
Article Name: Recombinant Rickettsia japonica 17KDA surface antigen (omp), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20380
Supplier Catalog Number: RPC20380
Alternative Catalog Number: BIM-RPC20380-20UG,BIM-RPC20380-100UG,BIM-RPC20380-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: omp, RJP_094417 kDa surface antigen
Recombinant Rickettsia japonica 17KDA surface antigen (omp) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rickettsia japonica (strain ATCC VR-1363 / YH). Target Name: omp. Target Synonyms: omp, RJP_094417 kDa surface antigen. Accession Number: Q52764. Expression Region: 20~159aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
Target: omp