Recombinant Rat Protein S100-A9 (S100a9), Unconjugated, E. coli

Catalog Number: BIM-RPC20382
Article Name: Recombinant Rat Protein S100-A9 (S100a9), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20382
Supplier Catalog Number: RPC20382
Alternative Catalog Number: BIM-RPC20382-20UG,BIM-RPC20382-100UG,BIM-RPC20382-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Calgranulin-BMigration inhibitory factor-related protein 14MRP-14p14Myeloid-related protein 14S100 calcium-binding protein A9
Recombinant Rat Protein S100-A9 (S100a9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: S100a9. Target Synonyms: Calgranulin-BMigration inhibitory factor-related protein 14MRP-14p14Myeloid-related protein 14S100 calcium-binding protein A9. Accession Number: P50116. Expression Region: 2~113aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 29kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Target: S100a9