Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase, Unconjugated, Yeast

Catalog Number: BIM-RPC20391
Article Name: Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20391
Supplier Catalog Number: RPC20391
Alternative Catalog Number: BIM-RPC20391-20UG,BIM-RPC20391-100UG,BIM-RPC20391-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Cyclodextrin-glycosyltransferaseCGTase
Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bacillus macerans. Target Name: Paenibacillus macerans Cyclomaltodextrin glucanotransferase. Target Synonyms: Cyclodextrin-glycosyltransferaseCGTase. Accession Number: P31835. Expression Region: 608~713aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 13.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN
Target: Paenibacillus macerans Cyclomaltodextrin glucanotransferase