Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB), Unconjugated, E. coli

Catalog Number: BIM-RPC20418
Article Name: Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20418
Supplier Catalog Number: RPC20418
Alternative Catalog Number: BIM-RPC20418-20UG,BIM-RPC20418-100UG,BIM-RPC20418-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Allergen Lol p IbAllergen Lol p VaAllergen: Lol p 5a
Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lolium perenne. Target Name: LOLPIB. Target Synonyms: Allergen Lol p IbAllergen Lol p VaAllergen: Lol p 5a. Accession Number: Q40240. Expression Region: 26~307aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 48.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.4kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVA
Target: LOLPIB