Recombinant E. coli Cytolethal distending toxin subunit B (cdtB), Unconjugated

Catalog Number: BIM-RPC20440
Article Name: Recombinant E. coli Cytolethal distending toxin subunit B (cdtB), Unconjugated
Biozol Catalog Number: BIM-RPC20440
Supplier Catalog Number: RPC20440
Alternative Catalog Number: BIM-RPC20440-20UG,BIM-RPC20440-100UG,BIM-RPC20440-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Deoxyribonuclease CdtB (EC:3.1.-.-)
Recombinant E. coli Cytolethal distending toxin subunit B (cdtB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: cdtB. Target Synonyms: Deoxyribonuclease CdtB (EC:3.1.-.-). Accession Number: Q46669. Expression Region: 19~269aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 47.4kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR
Target: cdtB