Recombinant Staphylococcus aureus Clumping factor A (clfA), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC20447
Article Name: Recombinant Staphylococcus aureus Clumping factor A (clfA), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20447
Supplier Catalog Number: RPC20447
Alternative Catalog Number: BIM-RPC20447-20UG,BIM-RPC20447-100UG,BIM-RPC20447-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Fibrinogen receptor AFibrinogen-binding protein A
Recombinant Staphylococcus aureus Clumping factor A (clfA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain COL). Target Name: clfA. Target Synonyms: Fibrinogen receptor AFibrinogen-binding protein A. Accession Number: Q5HHM8. Expression Region: 229~559aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 38kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 38kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQI
Target: clfA