Recombinant Rat Sulfotransferase 1A1 (Sult1a1), Unconjugated, E. coli

Catalog Number: BIM-RPC20456
Article Name: Recombinant Rat Sulfotransferase 1A1 (Sult1a1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20456
Supplier Catalog Number: RPC20456
Alternative Catalog Number: BIM-RPC20456-20UG,BIM-RPC20456-100UG,BIM-RPC20456-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Aryl sulfotransferaseAryl sulfotransferase IV
Recombinant Rat Sulfotransferase 1A1 (Sult1a1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Sult1a1. Target Synonyms: Aryl sulfotransferaseAryl sulfotransferase IV. Accession Number: P17988. Expression Region: 1~291aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 53.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKG
Target: Sult1a1