Recombinant Mouse L-dopachrome tautomerase (Dct), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20466
Article Name: Recombinant Mouse L-dopachrome tautomerase (Dct), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20466
Supplier Catalog Number: RPC20466
Alternative Catalog Number: BIM-RPC20466-20UG,BIM-RPC20466-100UG,BIM-RPC20466-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: DOPAchrome conversion factor1 DOPAchrome isomerase1 DOPAchrome oxidoreductase1 L-dopachrome Delta-isomeraseSLATY locus proteinTyrosinase-related protein 2
Recombinant Mouse L-dopachrome tautomerase (Dct), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Dct. Target Synonyms: DOPAchrome conversion factor1 DOPAchrome isomerase1 DOPAchrome oxidoreductase1 L-dopachrome Delta-isomeraseSLATY locus proteinTyrosinase-related protein 2. Accession Number: P29812. Expression Region: 24~472aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged. Theoretical MW: 69.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 69.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QFPRVCMTLDGVLNKECCPPLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNRKKPAILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFSHQGPAFVTWHRYHLLWLERELQRLTGNESFALPYWNFATGKNECDVCTDELLGAARQDDPTLISRNSR
Target: Dct