Recombinant Human Ornithine decarboxylase (ODC1), Unconjugated, E. coli

Catalog Number: BIM-RPC20474
Article Name: Recombinant Human Ornithine decarboxylase (ODC1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20474
Supplier Catalog Number: RPC20474
Alternative Catalog Number: BIM-RPC20474-20UG,BIM-RPC20474-100UG,BIM-RPC20474-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: DCOR_HUMAN, Dodc1, Odc 1, ODC, Odc1, ODC2, Ornithine decarboxylase 1, Ornithine decarboxylase 2, Ornithine decarboxylase, Ornithine decarboxylase structural 1, RNODC
Recombinant Human Ornithine decarboxylase (ODC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ODC1. Target Synonyms: DCOR_HUMAN, Dodc1, Odc 1, ODC, Odc1, ODC2, Ornithine decarboxylase 1, Ornithine decarboxylase 2, Ornithine decarboxylase, Ornithine decarboxylase structural 1, RNODC. Accession Number: P11926. Expression Region: 1~461aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 71.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 71.1kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVI
Target: ODC1