Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC20480
• Supplier Catalog Number: RPC20480
• Alternative Catalog Number: BIM-RPC20480-20UG,BIM-RPC20480-100UG,BIM-RPC20480-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Biliary glycoprotein 1

Product Description

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CEACAM1. Target Synonyms: Biliary glycoprotein 1. Accession Number: P13688. Expression Region: 35~428aa. Tag Info: Tag-Free. Theoretical MW: 43.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 43.3kDa
• Tag: Tag-Free
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNI
• Target: CEACAM1