Recombinant Salmonella typhi DNA-binding protein HU-beta (hupB), Unconjugated, E. coli

Catalog Number: BIM-RPC20489
Article Name: Recombinant Salmonella typhi DNA-binding protein HU-beta (hupB), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20489
Supplier Catalog Number: RPC20489
Alternative Catalog Number: BIM-RPC20489-20UG,BIM-RPC20489-100UG,BIM-RPC20489-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: HU-1NS1
Recombinant Salmonella typhi DNA-binding protein HU-beta (hupB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Salmonella typhi. Target Name: hupB. Target Synonyms: HU-1NS1. Accession Number: P0A1R9. Expression Region: 1~90aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.2kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN
Target: hupB