Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1), Unconjugated, E. coli

Catalog Number: BIM-RPC20493
Article Name: Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20493
Supplier Catalog Number: RPC20493
Alternative Catalog Number: BIM-RPC20493-20UG,BIM-RPC20493-100UG,BIM-RPC20493-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Zebrafish
Conjugation: Unconjugated
Alternative Names: sod1, cuzn, Superoxide dismutase [Cu-Zn], EC 1.15.1.1
Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio). Target Name: sod1. Target Synonyms: sod1, cuzn, Superoxide dismutase [Cu-Zn], EC 1.15.1.1. Accession Number: O73872. Expression Region: 1~154aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 37.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.1kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Target: sod1