Recombinant Human Forkhead box protein M1 (FOxM1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20494
Article Name: Recombinant Human Forkhead box protein M1 (FOxM1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20494
Supplier Catalog Number: RPC20494
Alternative Catalog Number: BIM-RPC20494-20UG,BIM-RPC20494-100UG,BIM-RPC20494-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Forkhead-related protein FKHL16Hepatocyte nuclear factor 3 forkhead homolog 11
Recombinant Human Forkhead box protein M1 (FOxM1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FOXM1. Target Synonyms: Forkhead-related protein FKHL16Hepatocyte nuclear factor 3 forkhead homolog 11. Accession Number: Q08050. Expression Region: 235~327aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 31.2kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Target: FOXM1