Recombinant Atlantic salmon Vertebrate ancient opsin, Unconjugated, E. coli

Catalog Number: BIM-RPC20498
Article Name: Recombinant Atlantic salmon Vertebrate ancient opsin, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20498
Supplier Catalog Number: RPC20498
Alternative Catalog Number: BIM-RPC20498-20UG,BIM-RPC20498-100UG,BIM-RPC20498-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fish
Conjugation: Unconjugated
Alternative Names: Vertebrate ancient opsin
Recombinant Atlantic salmon Vertebrate ancient opsin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Salmo salar (Atlantic salmon). Target Name: Atlantic salmon Vertebrate ancient opsin. Target Synonyms: Vertebrate ancient opsin. Accession Number: O13018. Expression Region: 1~75aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 22.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22.5kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Target: Atlantic salmon Vertebrate ancient opsin