Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp), Unconjugated, Yeast

Catalog Number: BIM-RPC20505
Article Name: Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20505
Supplier Catalog Number: RPC20505
Alternative Catalog Number: BIM-RPC20505-20UG,BIM-RPC20505-100UG,BIM-RPC20505-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: CHIPS
Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MRSA252). Target Name: chp. Target Synonyms: CHIPS. Accession Number: Q6GFB3. Expression Region: 29~149aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Target: chp