Recombinant E. coli Chaperone protein HtpG (htpG), Unconjugated

Catalog Number: BIM-RPC20508
Article Name: Recombinant E. coli Chaperone protein HtpG (htpG), Unconjugated
Biozol Catalog Number: BIM-RPC20508
Supplier Catalog Number: RPC20508
Alternative Catalog Number: BIM-RPC20508-20UG,BIM-RPC20508-100UG,BIM-RPC20508-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Heat shock protein C62.5Heat shock protein HtpGHigh temperature protein G
Recombinant E. coli Chaperone protein HtpG (htpG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: htpG. Target Synonyms: Heat shock protein C62.5Heat shock protein HtpGHigh temperature protein G. Accession Number: P0A6Z3. Expression Region: 1~624aa. Tag Info: Tag-Free. Theoretical MW: 71.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 71.4kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAH
Target: htpG