Recombinant Clostridium botulinum Penicillin-binding protein 1A (pbpA), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Clostridium botulinum Penicillin-binding protein 1A (pbpA), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC20510
• Supplier Catalog Number: RPC20510
• Alternative Catalog Number: BIM-RPC20510-20UG,BIM-RPC20510-100UG,BIM-RPC20510-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: Peptidoglycan TGaseDD-transpeptidase

Product Description

Recombinant Clostridium botulinum Penicillin-binding protein 1A (pbpA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A). Target Name: pbpA. Target Synonyms: Peptidoglycan TGaseDD-transpeptidase. Accession Number: A5I6G4. Expression Region: 663~830aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 35.2kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ
• Target: pbpA