Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail), Unconjugated, E. coli

Catalog Number: BIM-RPC20529
Article Name: Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20529
Supplier Catalog Number: RPC20529
Alternative Catalog Number: BIM-RPC20529-20UG,BIM-RPC20529-100UG,BIM-RPC20529-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: ailAttachment invasion locus protein
Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia enterocolitica. Target Name: ail. Target Synonyms: ailAttachment invasion locus protein. Accession Number: P16454. Expression Region: 24~178aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
Target: ail