Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20530
Article Name: Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20530
Supplier Catalog Number: RPC20530
Alternative Catalog Number: BIM-RPC20530-20UG,BIM-RPC20530-100UG,BIM-RPC20530-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: pbpD, BSU31490, Penicillin-binding protein 4, PBP 4, Includes: Penicillin-insensitive transglycosylase, EC 2.4.1.129, Peptidoglycan TGase, Penicillin-sensitive transpeptidase, EC 3.4.16.4, DD-transpeptidase
Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: pbpD. Target Synonyms: pbpD, BSU31490, Penicillin-binding protein 4, PBP 4, Includes: Penicillin-insensitive transglycosylase, EC 2.4.1.129, Peptidoglycan TGase, Penicillin-sensitive transpeptidase, EC 3.4.16.4, DD-transpeptidase. Accession Number: P40750. Expression Region: 213~450aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 43kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 43kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR
Target: pbpD