Recombinant Dahlia merckii Defensin-like protein 1, Unconjugated, E. coli

Catalog Number: BIM-RPC20535
Article Name: Recombinant Dahlia merckii Defensin-like protein 1, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20535
Supplier Catalog Number: RPC20535
Alternative Catalog Number: BIM-RPC20535-20UG,BIM-RPC20535-100UG,BIM-RPC20535-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Cysteine-rich antimicrobial protein 1Defensin AMP1
Recombinant Dahlia merckii Defensin-like protein 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dahlia merckii (Bedding dahlia). Target Name: Dahlia merckii Defensin-like protein 1. Target Synonyms: Cysteine-rich antimicrobial protein 1Defensin AMP1. Accession Number: P0C8Y4. Expression Region: 1~50aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 19.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.5kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC
Target: Dahlia merckii Defensin-like protein 1