Recombinant Portulaca grandiflora 4, 5-DOPA dioxygenase extradiol (DODA), Unconjugated, E. coli

Catalog Number: BIM-RPC20539
Article Name: Recombinant Portulaca grandiflora 4, 5-DOPA dioxygenase extradiol (DODA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20539
Supplier Catalog Number: RPC20539
Alternative Catalog Number: BIM-RPC20539-20UG,BIM-RPC20539-100UG,BIM-RPC20539-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: DODA4,5-DOPA dioxygenase extradiol, EC 1.13.11.29
Recombinant Portulaca grandiflora 4, 5-DOPA dioxygenase extradiol (DODA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Portulaca grandiflora (Rose moss). Target Name: DODA. Target Synonyms: DODA4,5-DOPA dioxygenase extradiol, EC 1.13.11.29. Accession Number: Q7XA48. Expression Region: 1~271aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 49.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRT
Target: DODA