Recombinant Mycobacterium tuberculosis Putative amidase AmiB2 (amiB2), Unconjugated, E. coli

Catalog Number: BIM-RPC20549
Article Name: Recombinant Mycobacterium tuberculosis Putative amidase AmiB2 (amiB2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20549
Supplier Catalog Number: RPC20549
Alternative Catalog Number: BIM-RPC20549-20UG,BIM-RPC20549-100UG,BIM-RPC20549-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: amiB2, Rv1263, MTCY50.19cPutative amidase AmiB2, EC 3.5.1.4
Recombinant Mycobacterium tuberculosis Putative amidase AmiB2 (amiB2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Target Name: amiB2. Target Synonyms: amiB2, Rv1263, MTCY50.19cPutative amidase AmiB2, EC 3.5.1.4. Accession Number: P9WQ97. Expression Region: 1~462aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 69.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 69.1kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERLPLLGVPIAIKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGSAAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATTTVPGPEGEFVAAAARQPGRLRIA
Target: amiB2