Recombinant Mouse Fas apoptotic inhibitory molecule 3 (Fcmr), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Mouse Fas apoptotic inhibitory molecule 3 (Fcmr), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC21299
• Supplier Catalog Number: RPC21299
• Alternative Catalog Number: BIM-RPC21299-20UG,BIM-RPC21299-100UG,BIM-RPC21299-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Regulator of Fas-induced apoptosis Toso

Product Description

Recombinant Mouse Fas apoptotic inhibitory molecule 3 (Fcmr), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Faim3. Target Synonyms: Regulator of Fas-induced apoptosis Toso. Accession Number: A1KXC4. Expression Region: 18~262aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 43.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 43.9kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPE
• Target: Faim3