Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC22590
• Supplier Catalog Number: RPC22590
• Alternative Catalog Number: BIM-RPC22590-20UG,BIM-RPC22590-100UG,BIM-RPC22590-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: SEC2

Product Description

Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: entC2. Target Synonyms: SEC2. Accession Number: P34071. Expression Region: 28~266aa. Tag Info: Tag-Free. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 27.6kDa
• Tag: Tag-Free
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
• Target: entC2