Recombinant Neosartorya fumigata Hydrophobin (rodA), Unconjugated, E. coli

Catalog Number: BIM-RPC22597
Article Name: Recombinant Neosartorya fumigata Hydrophobin (rodA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22597
Supplier Catalog Number: RPC22597
Alternative Catalog Number: BIM-RPC22597-20UG,BIM-RPC22597-100UG,BIM-RPC22597-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: Rodlet protein
Recombinant Neosartorya fumigata Hydrophobin (rodA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus). Target Name: rodA. Target Synonyms: Rodlet protein. Accession Number: P41746. Expression Region: 19~159aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 28.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.3kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL
Target: rodA