Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1), Unconjugated, E. coli

Catalog Number: BIM-RPC22631
Article Name: Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22631
Supplier Catalog Number: RPC22631
Alternative Catalog Number: BIM-RPC22631-20UG,BIM-RPC22631-100UG,BIM-RPC22631-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: Hydrophobin IHFBI
Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hypocrea jecorina (Trichoderma reesei). Target Name: hfb1. Target Synonyms: Hydrophobin IHFBI. Accession Number: P52754. Expression Region: 23~97aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA
Target: hfb1