Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC22665
• Supplier Catalog Number: RPC22665
• Alternative Catalog Number: BIM-RPC22665-20UG,BIM-RPC22665-100UG,BIM-RPC22665-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: CELIAC1, DQ beta 1 chain, DQB1_HUMAN, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen, DQ beta 1 chain, HLA class II histocompatibility antigen, DQ beta 2 chain, HLA DQB, HLA DQB1, HLA-DQB1, HLA-DQB2, IDDM1, Lymphocyte antigen, Major histocompatibility complex class II beta, Major histocompatibility complex, class II, DQ beta 1, MHC class II antigen DQB1, MHC class II antigen HLA DQ beta 1, MHC class II DQ beta chain, MHC class II HLA DQ beta glycoprotein, MHC class2 antigen, MHC DQ beta, OTTHUMP00000029167, OTTHUMP00000178569, OTTHUMP00000178570, OTTHUMP00000178571

Product Description

Recombinant Human HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HLA-DQB1. Target Synonyms: CELIAC1, DQ beta 1 chain, DQB1_HUMAN, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen, DQ beta 1 chain, HLA class II histocompatibility antigen, DQ beta 2 chain, HLA DQB, HLA DQB1. Accession Number: P01920. Expression Region: 33~227aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 27kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >85% by SDS-PAGE
• Sequence: RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA
• Target: HLA-DQB1