Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains, Unconjugated, E. coli

Catalog Number: BIM-RPC22667
Article Name: Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22667
Supplier Catalog Number: RPC22667
Alternative Catalog Number: BIM-RPC22667-20UG,BIM-RPC22667-100UG,BIM-RPC22667-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Sarcoplasmic calcium-binding protein, alpha-B and -A chains, SCP alpha chain
Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Penaeus sp. (Penoeid shrimp). Target Name: Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains. Target Synonyms: Sarcoplasmic calcium-binding protein, alpha-B and -A chains, SCP alpha chain. Accession Number: P02636. Expression Region: 1~192aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 42kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AYSWDNRVKYVVRYMYDIDDDGFLDKNDFECLAVRNTLIEGRGEFSAADYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKMAVQKHCQGKKYSEFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYDKLTTEDDRKAGGLTLERYQDLYAQFISNPNESCSACFLFGPLKVVQ
Target: Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains