Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X), Unconjugated, E. coli

Catalog Number: BIM-RPC22672
Article Name: Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22672
Supplier Catalog Number: RPC22672
Alternative Catalog Number: BIM-RPC22672-20UG,BIM-RPC22672-100UG,BIM-RPC22672-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: HBxPeptide XpX
Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D). Target Name: X. Target Synonyms: HBxPeptide XpX. Accession Number: P03165. Expression Region: 1~154aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
Target: X