Recombinant Coturnix delegorguei Ovomucoid, Unconjugated, E. coli

Catalog Number: BIM-RPC22691
Article Name: Recombinant Coturnix delegorguei Ovomucoid, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22691
Supplier Catalog Number: RPC22691
Alternative Catalog Number: BIM-RPC22691-20UG,BIM-RPC22691-100UG,BIM-RPC22691-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Ovomucoid, Fragment
Recombinant Coturnix delegorguei Ovomucoid is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Coturnix delegorguei (Harlequin quail). Target Name: Coturnix delegorguei Ovomucoid. Target Synonyms: Ovomucoid, Fragment. Accession Number: P05600. Expression Region: 1~52aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 25.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC
Target: Coturnix delegorguei Ovomucoid