Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2), Unconjugated, E. coli

Catalog Number: BIM-RPC22708
Article Name: Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22708
Supplier Catalog Number: RPC22708
Alternative Catalog Number: BIM-RPC22708-20UG,BIM-RPC22708-100UG,BIM-RPC22708-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Verocytotoxin 2 subunit B, Verotoxin 2 subunit B
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage 933W (Bacteriophage 933W). Target Name: stxB2. Target Synonyms: Verocytotoxin 2 subunit B, Verotoxin 2 subunit B. Accession Number: P09386. Expression Region: 20~89aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Target: stxB2