Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22710
Article Name: Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22710
Supplier Catalog Number: RPC22710
Alternative Catalog Number: BIM-RPC22710-20UG,BIM-RPC22710-100UG,BIM-RPC22710-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Stable signal peptideSSPGlycoprotein G1GP1Glycoprotein G2GP2
Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV). Target Name: GPC. Target Synonyms: Stable signal peptideSSPGlycoprotein G1GP1Glycoprotein G2GP2. Accession Number: P09991. Expression Region: 266~498aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 42.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR
Target: GPC