Recombinant E. coli DNA replication and repair protein RecF (recF), Unconjugated

Catalog Number: BIM-RPC22720
Article Name: Recombinant E. coli DNA replication and repair protein RecF (recF), Unconjugated
Biozol Catalog Number: BIM-RPC22720
Supplier Catalog Number: RPC22720
Alternative Catalog Number: BIM-RPC22720-20UG,BIM-RPC22720-100UG,BIM-RPC22720-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: recF, uvrF, b3700, JW3677, DNA replication and repair protein RecF
Recombinant E. coli DNA replication and repair protein RecF (recF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: recF. Target Synonyms: recF, uvrF, b3700, JW3677, DNA replication and repair protein RecF. Accession Number: P0A7H0. Expression Region: 2~357aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRVIRHEQEAFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGTDGHKVAELAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNAALRQVTRYEQLRPWDKELIPLAEQISTWRAEYSAGIAADMADTCKQFLPEFSLTFSFQRGWEKETEYAEVLERNFERDRQLTYTAHGPHKADL
Target: recF