Recombinant E. coli O157:H7 Outer membrane protein A (ompA), partial, Unconjugated

Catalog Number: BIM-RPC22724
Article Name: Recombinant E. coli O157:H7 Outer membrane protein A (ompA), partial, Unconjugated
Biozol Catalog Number: BIM-RPC22724
Supplier Catalog Number: RPC22724
Alternative Catalog Number: BIM-RPC22724-20UG,BIM-RPC22724-100UG,BIM-RPC22724-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Outer membrane protein II
Recombinant E. coli O157:H7 Outer membrane protein A (ompA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: ompA. Target Synonyms: Outer membrane protein II. Accession Number: P0A911. Expression Region: 164~346aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 35.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Target: ompA