Recombinant Mouse Major urinary protein 6 (Mup6), Unconjugated, E. coli

Catalog Number: BIM-RPC22751
Article Name: Recombinant Mouse Major urinary protein 6 (Mup6), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22751
Supplier Catalog Number: RPC22751
Alternative Catalog Number: BIM-RPC22751-20UG,BIM-RPC22751-100UG,BIM-RPC22751-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Alpha-2U-globulinGroup 1, BS6Allergen: Mus m 1
Recombinant Mouse Major urinary protein 6 (Mup6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mup6. Target Synonyms: Alpha-2U-globulinGroup 1, BS6Allergen: Mus m 1. Accession Number: P02762. Expression Region: 19~180aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Target: Mup6