Recombinant Pseudomonas sp. Carboxypeptidase G2 (cpg2), Unconjugated, E. coli

Catalog Number: BIM-RPC22772
Article Name: Recombinant Pseudomonas sp. Carboxypeptidase G2 (cpg2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22772
Supplier Catalog Number: RPC22772
Alternative Catalog Number: BIM-RPC22772-20UG,BIM-RPC22772-100UG,BIM-RPC22772-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN: Glucarpidase
Recombinant Pseudomonas sp. Carboxypeptidase G2 (cpg2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas sp. (strain RS-16). Target Name: cpg2. Target Synonyms: Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN: Glucarpidase. Accession Number: P06621. Expression Region: 23~415aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 68.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 68.7kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNII
Target: cpg2