Recombinant Human rhinovirus A serotype 89 Genome polyprotein, Unconjugated, E. coli
Catalog Number:
BIM-RPC22779
- Images (0)
| Article Name: | Recombinant Human rhinovirus A serotype 89 Genome polyprotein, Unconjugated, E. coli |
| Biozol Catalog Number: | BIM-RPC22779 |
| Supplier Catalog Number: | RPC22779 |
| Alternative Catalog Number: | BIM-RPC22779-20UG,BIM-RPC22779-100UG,BIM-RPC22779-1MG |
| Manufacturer: | Biomatik Corporation |
| Host: | E. coli |
| Category: | Proteine/Peptide |
| Species Reactivity: | Virus |
| Conjugation: | Unconjugated |
| Alternative Names: | Genome polyprotein, Cleaved into: P1, Capsid protein VP0, VP4-VP2, Capsid protein VP4, P1A, Virion protein 4, Capsid protein VP2, P1B, Virion protein 2, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, P2, Protease 2A, P2A, EC 3.4.22.29, Picornain 2A, Protein 2A, Protein 2B, P2B, Protein 2C, P2C, EC 3.6.1.15, P3, Protein 3AB, Protein 3A, P3A, Viral protein genome-linked, VPg, Protein 3B, P3B, Protein 3CD, EC 3.4.22.28, Protease 3C, EC 3.4.22.28, Picornain 3C, P3C, RNA-directed RNA polymerase, RdRp, EC 2.7.7.48, 3D polymerase, 3Dpol, Protein 3D, 3D |
| Recombinant Human rhinovirus A serotype 89 Genome polyprotein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89). Target Name: Human rhinovirus A serotype 89 Genome polyprotein. Target Synonyms: Genome polyprotein, Cleaved into: P1, Capsid protein VP0, VP4-VP2, Capsid protein VP4, P1A, Virion protein 4, Capsid protein VP2. Accession Number: P07210. Expression Region: 575~866aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
| Molecular Weight: | 38.1kDa |
| Tag: | N-Terminal 10Xhis-Tagged |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity: | >85% by SDS-PAGE |
| Sequence: | NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRP |
| Target: | Human rhinovirus A serotype 89 Genome polyprotein |
