Recombinant Borrelia burgdorferi Outer surface protein A (ospA), Unconjugated, E. coli

Catalog Number: BIM-RPC22789
Article Name: Recombinant Borrelia burgdorferi Outer surface protein A (ospA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22789
Supplier Catalog Number: RPC22789
Alternative Catalog Number: BIM-RPC22789-20UG,BIM-RPC22789-100UG,BIM-RPC22789-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: ospA, Outer surface protein A
Recombinant Borrelia burgdorferi Outer surface protein A (ospA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Borreliella burgdorferi (Lyme disease spirochete) (Borrelia burgdorferi). Target Name: ospA. Target Synonyms: ospA, Outer surface protein A. Accession Number: P0A3N6. Expression Region: 17~273aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNA
Target: ospA