Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51), Unconjugated, E. coli

Catalog Number: BIM-RPC22791
Article Name: Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22791
Supplier Catalog Number: RPC22791
Alternative Catalog Number: BIM-RPC22791-20UG,BIM-RPC22791-100UG,BIM-RPC22791-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: mpt51, fbpC1, fbpD, mpb51, MT3910, MPT51/MPB51 antigen
Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Target Name: mpt51. Target Synonyms: mpt51, fbpC1, fbpD, mpb51, MT3910, MPT51/MPB51 antigen. Accession Number: P9WQN6. Expression Region: 27~299aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWG
Target: mpt51