Recombinant E. coli Cytidylate kinase (cmk), Unconjugated

Catalog Number: BIM-RPC22794
Article Name: Recombinant E. coli Cytidylate kinase (cmk), Unconjugated
Biozol Catalog Number: BIM-RPC22794
Supplier Catalog Number: RPC22794
Alternative Catalog Number: BIM-RPC22794-20UG,BIM-RPC22794-100UG,BIM-RPC22794-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Cytidine monophosphate kinase, CMP kinaseProtein MssAp25
Recombinant E. coli Cytidylate kinase (cmk) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: cmk. Target Synonyms: Cytidine monophosphate kinase, CMP kinaseProtein MssAp25. Accession Number: P0A6I0. Expression Region: 1~227aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 40.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 40.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA
Target: cmk