Recombinant E. coli Crossover junction endodeoxyribonuclease RuvC (ruvC), Unconjugated

Catalog Number: BIM-RPC22800
Article Name: Recombinant E. coli Crossover junction endodeoxyribonuclease RuvC (ruvC), Unconjugated
Biozol Catalog Number: BIM-RPC22800
Supplier Catalog Number: RPC22800
Alternative Catalog Number: BIM-RPC22800-20UG,BIM-RPC22800-100UG,BIM-RPC22800-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Holliday junction nuclease RuvCHolliday junction resolvase RuvC
Recombinant E. coli Crossover junction endodeoxyribonuclease RuvC (ruvC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: ruvC. Target Synonyms: Holliday junction nuclease RuvCHolliday junction resolvase RuvC. Accession Number: P0A814. Expression Region: 2~173aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR
Target: ruvC