Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22805
Article Name: Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22805
Supplier Catalog Number: RPC22805
Alternative Catalog Number: BIM-RPC22805-20UG,BIM-RPC22805-100UG,BIM-RPC22805-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: PETE, Plastocyanin, chloroplastic
Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Spinacia oleracea (Spinach). Target Name: PETE. Target Synonyms: PETE, Plastocyanin, chloroplastic. Accession Number: P00289. Expression Region: 70~168aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 26.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Target: PETE