Recombinant Naja kaouthia Alpha-cobratoxin, Unconjugated, E. coli

Catalog Number: BIM-RPC22809
Article Name: Recombinant Naja kaouthia Alpha-cobratoxin, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22809
Supplier Catalog Number: RPC22809
Alternative Catalog Number: BIM-RPC22809-20UG,BIM-RPC22809-100UG,BIM-RPC22809-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Reptile
Conjugation: Unconjugated
Alternative Names: Alpha-elapitoxin-Nk2aAlpha-EPTX-Nk2aLong neurotoxin 1Siamensis 3
Recombinant Naja kaouthia Alpha-cobratoxin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Naja kaouthia (Monocled cobra) (Naja siamensis). Target Name: Naja kaouthia Alpha-cobratoxin. Target Synonyms: Alpha-elapitoxin-Nk2aAlpha-EPTX-Nk2aLong neurotoxin 1Siamensis 3. Accession Number: P01391. Expression Region: 1~71aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 37.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.8kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP
Target: Naja kaouthia Alpha-cobratoxin